Overview

  • Product name
    Recombinant Human SPON2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAA HSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSAHEVFSA PAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRW REQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFY YPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPL DCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECV PDNCV
    • Amino acids
      27 to 331
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Differentially expressed in cancerous and non-cancerous lung cells 1
    • DIL 1
    • DIL-1
    • DIL1
    • DKFZp686G21139
    • FLJ16313
    • FLJ22401
    • FLJ34460
    • M spondin
    • Mindin
    • ORF Names:
    • SPON 2
    • Spon2
    • SPON2_HUMAN
    • Spondin 2
    • Spondin 2 extracellular matrix protein
    • Spondin-2
    see all
  • Function
    Cell adhesion protein that promotes adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. Essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens (By similarity). Binds bacterial lipopolysaccharide (LPS).
  • Tissue specificity
    Expressed in normal lung tissue but not in lung carcinoma cell lines.
  • Sequence similarities
    Contains 1 spondin domain.
    Contains 1 TSP type-1 domain.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab160977 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up