Overview

  • Product name
    Recombinant Human SPOP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSRVPSPPPPAEMSSGPVAESWCYTQIKVV KFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEES KDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKD WGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFE HEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHAS DVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 374
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105599 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab105599 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 50% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 2mM EDTA, pH 8.0

General Info

  • Alternative names
    • BTBD32
    • HIB homolog 1
    • Roadkill homolog 1
    • Speckle type POZ protein
    • Speckle-type POZ protein
    • SPOP
    • SPOP_HUMAN
    • TEF 2
    • TEF2
    see all
  • Function
    Inhibits IPF1/PDX1 transactivation of established target promoters, such as insulin, may be by recruiting a repressor complex (By similarity). In complex with CUL3, involved in ubiquitination of BMI1, H2AFY and DAXX, and probably also in ubiquitination and proteasomal degradation of Gli2 or Gli3.
  • Tissue specificity
    Widely expressed.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the Tdpoz family.
    Contains 1 BTB (POZ) domain.
    Contains 1 MATH domain.
  • Domain
    The MATH domain interacts with H2AFY and BMI1.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human SPOP protein images

  • 15% SDS-PAGE analysis of 3µg ab105599.

References for Recombinant Human SPOP protein (ab105599)

ab105599 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105599.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up