Recombinant Human SPRED2 protein (ab165867)

Overview

  • Product name
    Recombinant Human SPRED2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EDLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSP TSCEHRRIYTLGHLHDSYPTDHYHLDQPMPRPCRQVSFPDDDEEIVRINP
    • Amino acids
      120 to 219
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C79158
    • FLJ21897
    • FLJ31917
    • MGC163164
    • Spred 2
    • Sprouty protein with EVH 1 domain 2 related sequence
    • sprouty related EVH1 domain containing 2
    • Sprouty related protein with EVH 1 domain 2
    • zgc:77284
    see all
  • Relevance
    Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase.
  • Cellular localization
    Cell Membrane - peripheral membrane protein and Cytoplasmic

Images

  • ab165867 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up