Recombinant Human Sprouty 4 protein (ab153536)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VQSRTSSPMEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQ VKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVTHHWISF
    • Amino acids
      16 to 115
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Protein sprouty homolog 4
    • Sprouty homolog 4
    • sprouty homolog 4 (Drosophila)
    • SPRY 4
    • Spry-4
    • Spry4
    • SPY4_HUMAN
    see all
  • Function
    Suppresses the insulin receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras. Probably impairs the formation of GTP-Ras.
  • Sequence similarities
    Belongs to the sprouty family.
    Contains 1 SPR (sprouty) domain.
  • Domain
    The Cys-rich domain is responsible for the localization of the protein to the membrane ruffles.
  • Cellular localization
    Cytoplasm. Cell projection > ruffle membrane.
  • Information by UniProt

Images

  • ab153536 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up