Recombinant Human SPRR1a protein (ab159572)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNSQQQKQPCTPPPQPQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCH PKVPEPCQPKVPEPCQPKVPEPCPSTVTPAPAQQKTKQK
    • Amino acids
      1 to 89
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 19 kDa pancornulin
    • Cornifin A
    • Cornifin alpha
    • CornifinA
    • Small proline rich protein 1A
    • Small proline rich protein IA
    • spr
    • SPR IA
    • SPRK
    • SPRR 1a
    • SPRR1A protein
    see all
  • Relevance
    The ability of neurons to regenerate an axon after injury is determined by both the surrounding environment and factors intrinsic to the damaged neuron. Neuronal SPRR1A is likely a significant contributor to successful nerve regeneration. The small proline-rich repeat protein 1A (SPRR1A) is not detectable in uninjured neurons but is induced by >60-fold after peripheral axonal damage being localized to injured neurons and axons. SPRR1A is one of a group of epithelial differentiation genes, including s100c and p21/waf, that are cocurrently induced in neurons by axotomy. Overexpressed SPRR1A colocalizes with F-actin in membrane ruffles and augments axonal outgrowth on a range of substrates. In axotomized sensory neurons, reduction of SPRR1A function restricts axonal outgrowth.
  • Cellular localization
    Cytoplasmic

Images

  • ab159572 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159572 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159572.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up