Overview

  • Product nameRecombinant Human SPRR3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9UBC9
    • SpeciesHuman
    • SequenceMSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGN TKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTK VPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVT PGPAQQKTKQK
    • Molecular weight44 kDa including tags
    • Amino acids1 to 161

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 22 kDa pancornulin
    • Cornifin beta
    • Esophagin
    • Small proline rich protein 3
    • Small proline-rich protein 3
    • SPRC
    • Sprr3
    • SPRR3_HUMAN
    see all
  • FunctionCross-linked envelope protein of keratinocytes.
  • Sequence similaritiesBelongs to the cornifin (SPRR) family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SPRR3 protein images

  • 12.5% SDS-PAGE showing ab116771 at approximately 43.82kDa stained with Coomassie Blue.

References for Recombinant Human SPRR3 protein (ab116771)

ab116771 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"