Overview

  • Product name
    Recombinant Human SPSB1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMQELQGLDYCKPTRLDLLLDMPPVSYDVQL LHSWNNNDRSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQI TWAMRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESWGWDLGRNRLYHD GKNQPSKTYPAFLEPDETFIVPDSFLVALDMDDGTLSFIVDGQYMGVAFR GLKGKKLYPVVSAVWGHCEIRMRYLNGLDPE
    • Molecular weight
      26 kDa
    • Amino acids
      24 to 233
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab107155 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 1110014L01Rik
    • 4930422J18Rik
    • AI596360
    • AI854583
    • MGC102221
    • novel SPRY domain containing protein
    • OTTHUMP00000001398
    • OTTMUSP00000010942
    • OTTMUSP00000010943
    • OTTMUSP00000023475
    • RGD1309319
    • RP23-169H13.1
    • RP3-324M8.1
    • splA/ryanodine receptor domain and SOCS box containing 1
    • SPRY domain containing SOCS box protein SSB 1
    • SPRY domain-containing SOCS box protein 1
    • SPSB1
    • SPSB1_HUMAN
    • SSB 1
    • SSB-1
    • SSB1
    see all
  • Function
    Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the SPSB family.
    Contains 1 B30.2/SPRY domain.
    Contains 1 SOCS box domain.
  • Domain
    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin ligase complexes (By similarity). The B30.2/SPRY domain is involved in MET binding.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human SPSB1 protein images

  • 15% SDS-PAGE showing ab107155 (3µg).

References for Recombinant Human SPSB1 protein (ab107155)

ab107155 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up