Overview

  • Product name
    Recombinant Human SPT3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVVFGTTFFNFDSFIGKTDSIEIIGKSVFPYCYHNILPLLNDSGRYSLGD ARRPLHETAVLVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRK DKKKLRRLLKYMFIRDYKSKIVKGIDEDDLLEDKLSGSNNANKRQKIAQD FLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSAQYAEFCESR QLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLV RQDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREA IRRYSHRIGPLSPFTNAYRRNGMAFLAC
    • Amino acids
      1 to 328
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Positive regulator of Ty transcription
    • SPT3
    • SPT3 like protein
    • Spt3p
    • SUPT3H
    • Transcription initiation protein SPT3 homolog
    • YDR392W
    see all
  • Relevance
    SPT factors 3, 7 and 8 are required for the initiation of Ty transcription from the delta promoter. SPT3 regulates Ty1 as well as the mating factor genes. It interacts directly with TATA-binding protein, and is likely to be required for normal TBP function at a subset of RNA polymerase II-dependent promoters.
  • Cellular localization
    Nuclear

Images

  • ab160044 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up