Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSK LFRNPVTNDR
    • Amino acids
      251 to 360
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ACTR
    • AIB 1
    • AIB-1
    • AIB1
    • Amplified in breast cancer 1
    • Amplified in breast cancer 1 protein
    • bHLHe42
    • CAGH 16
    • CAGH16
    • CBP interacting protein
    • CBP-interacting protein
    • Class E basic helix-loop-helix protein 42
    • CTG 26
    • CTG26
    • KAT13B / AIB1
    • MGC141848
    • NCOA 3
    • NCoA-3
    • Ncoa3
    • NCOA3_HUMAN
    • Nuclear receptor coactivator 3
    • pCIP
    • RAC 3
    • RAC-3
    • RAC3
    • Receptor associated coactivator 3
    • Receptor-associated coactivator 3
    • SRC 3
    • SRC-3
    • SRC3
    • Steroid receptor coactivator protein 3
    • Thyroid hormone receptor activator molecule 1
    • TNRC14
    • TNRC16
    • TRAM 1
    • TRAM-1
    • TRAM1
    see all
  • Function
    Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Plays a central role in creating a multisubunit coactivator complex, which probably acts via remodeling of chromatin. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ER), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Displays histone acetyltransferase activity. Also involved in the coactivation of the NF-kappa-B pathway via its interaction with the NFKB1 subunit. Interacts with PSMB9.
  • Tissue specificity
    Widely expressed. High expression in heart, skeletal muscle, pancreas and placenta. Low expression in brain, and very low in lung, liver and kidney.
  • Sequence similarities
    Belongs to the SRC/p160 nuclear receptor coactivator family.
    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAS (PER-ARNT-SIM) domain.
  • Domain
    Contains three Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs. Motifs 1 and 2 are essential for the association with nuclear receptors, and constitute the RID domain (Receptor-interacting domain).
  • Post-translational
    modifications
    Acetylated by CREBBP. Acetylation occurs in the RID domain, and disrupts the interaction with nuclear receptors and regulates its function.
    Methylated by CARM1.
    Phosphorylated by IKK complex. Regulated its function.
  • Cellular localization
    Cytoplasm. Nucleus. Mainly cytoplasmic and weakly nuclear. Upon TNF activation and subsequent phosphorylation, it translocates from the cytoplasm to the nucleus.
  • Information by UniProt

Images

  • ab159961 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up