Recombinant Human SRCRB4D protein (ab165402)

Overview

  • Product name
    Recombinant Human SRCRB4D protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTGTLRTRAWPAAKRAAGLRWALRDEARLSDCFHLGWGQHNCGHHEDAGA LCAGEADSEGPEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAHRCEGR VELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPI LLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
    • Amino acids
      1 to 190
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • S4D SRCRB
    • Scavenger receptor cysteine rich domain containing group B
    • Scavenger receptor cysteine rich domain containing group B (4 domains)
    • Scavenger receptor cysteine rich protein SRCRB S4D
    • SRCRB S4D
    • SSC4D
    see all
  • Relevance
    SRCRB4D (Scavenger receptor cysteine rich domain containing, group B (4 domains)) is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. The scavenger receptor cysteine-rich superfamily is a highly conserved group of membrane and/or secreted proteins related to the innate and adaptive immune system.

Images

  • ab165402 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up