Recombinant Human SRD5A1 protein (ab116886)

Overview

  • Product name
    Recombinant Human SRD5A1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRV PARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCL IYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPR FLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF GEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKF RKIIIPFLF
    • Molecular weight
      55 kDa including tags
    • Amino acids
      1 to 259
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris-HCl buffer

General Info

  • Alternative names
    • 3 oxo 5 alpha steroid 4 dehydrogenase 1
    • 3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1
    • 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1,5-alpha reductase
    • 3-oxo-5-alpha-steroid 4-dehydrogenase 1
    • 5 alpha reductase
    • S5A1_HUMAN
    • S5AR
    • S5AR 1
    • SR type 1
    • SRD5A 1
    • Srd5a1
    • Steroid 5 alpha reductase 1
    • Steroid 5 alpha reductase alpha polypeptide 1
    • Steroid 5 alpha reductase alpha polypeptide 1 (3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1)
    • Steroid 5 alpha reductase type I
    • Steroid 5-alpha-reductase 1
    see all
  • Function
    Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
  • Tissue specificity
    Liver and prostate (at a low level).
  • Sequence similarities
    Belongs to the steroid 5-alpha reductase family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116886 at approximately 54.60kDa, stained with Coomassie Blue

References

ab116886 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up