Recombinant Human SRD5A1 protein (ab116886)

Overview

  • Product name
    Recombinant Human SRD5A1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRV PARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCL IYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPR FLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF GEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKF RKIIIPFLF
    • Molecular weight
      55 kDa including tags
    • Amino acids
      1 to 259
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris-HCl buffer

General Info

  • Alternative names
    • 3 oxo 5 alpha steroid 4 dehydrogenase 1
    • 3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1
    • 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1,5-alpha reductase
    • 3-oxo-5-alpha-steroid 4-dehydrogenase 1
    • 5 alpha reductase
    • S5A1_HUMAN
    • S5AR
    • S5AR 1
    • SR type 1
    • SRD5A 1
    • Srd5a1
    • Steroid 5 alpha reductase 1
    • Steroid 5 alpha reductase alpha polypeptide 1
    • Steroid 5 alpha reductase alpha polypeptide 1 (3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1)
    • Steroid 5 alpha reductase type I
    • Steroid 5-alpha-reductase 1
    see all
  • Function
    Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
  • Tissue specificity
    Liver and prostate (at a low level).
  • Sequence similarities
    Belongs to the steroid 5-alpha reductase family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human SRD5A1 protein images

  • 12.5% SDS-PAGE showing ab116886 at approximately 54.60kDa, stained with Coomassie Blue

References for Recombinant Human SRD5A1 protein (ab116886)

ab116886 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up