Recombinant Human SRD5A1 protein (ab116886)

Overview

  • Product nameRecombinant Human SRD5A1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP18405
    • SpeciesHuman
    • SequenceMATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRV PARAAWVVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCL IYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPR FLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYF GEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKF RKIIIPFLF
    • Molecular weight55 kDa including tags
    • Amino acids1 to 259
    • TagsGST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116886 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris-HCl buffer

General Info

  • Alternative names
    • 3 oxo 5 alpha steroid 4 dehydrogenase 1
    • 3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1
    • 3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1,5-alpha reductase
    • 3-oxo-5-alpha-steroid 4-dehydrogenase 1
    • 5 alpha reductase
    • S5A1_HUMAN
    • S5AR
    • S5AR 1
    • SR type 1
    • SRD5A 1
    • Srd5a1
    • Steroid 5 alpha reductase 1
    • Steroid 5 alpha reductase alpha polypeptide 1
    • Steroid 5 alpha reductase alpha polypeptide 1 (3 oxo 5 alpha steroid delta 4 dehydrogenase alpha 1)
    • Steroid 5 alpha reductase type I
    • Steroid 5-alpha-reductase 1
    see all
  • FunctionConverts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
  • Tissue specificityLiver and prostate (at a low level).
  • Sequence similaritiesBelongs to the steroid 5-alpha reductase family.
  • Cellular localizationMicrosome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human SRD5A1 protein images

  • 12.5% SDS-PAGE showing ab116886 at approximately 54.60kDa, stained with Coomassie Blue

References for Recombinant Human SRD5A1 protein (ab116886)

ab116886 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116886.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"