Recombinant Human SRD5A2 protein (ab114946)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
    • Molecular weight
      30 kDa including tags
    • Amino acids
      28 to 65

Specifications

Our Abpromise guarantee covers the use of ab114946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 oxo 5 alpha steroid 4 dehydrogenase 2
    • 3-oxo-5-alpha-steroid 4-dehydrogenase 2
    • 5 alpha SR2
    • 5 alpha-SR2
    • 5ART2
    • e II 5 alpha reductase
    • EC
    • MGC138457
    • Micropenis, included
    • S5A2_HUMAN
    • S5AR 2
    • SR type 2
    • SRD5A2
    • Steroid 5 alpha reductase 2
    • Steroid 5-alpha-reductase 2
    • Steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
    • Type II 5-alpha reductase
    see all
  • Function
    Converts testosterone (T) into 5-alpha-dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
  • Tissue specificity
    Expressed in high levels in the prostate and many other androgen-sensitive tissues.
  • Involvement in disease
    Defects in SRD5A2 are the cause of pseudovaginal perineoscrotal hypospadias (PPSH) [MIM:264600]. A form of male pseudohermaphroditism in which 46,XY males show ambiguous genitalia at birth, including perineal hypospadias and a blind perineal pouch, and develop masculinization at puberty. The name of the disorder stems from the finding of a blind-ending perineal opening resembling a vagina and a severely hypospadiac penis with the urethra opening onto the perineum.
  • Sequence similarities
    Belongs to the steroid 5-alpha reductase family.
  • Cellular localization
    Microsome membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human SRD5A2 protein images

  • 12.5% SDS-PAGE showing ab114946 at approximately 29.81kDa.
    Stained with Coomassie Blue.

References for Recombinant Human SRD5A2 protein (ab114946)

ab114946 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up