Recombinant Human SREBP2 protein (ab114215)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ12772
    • SpeciesHuman
    • SequenceQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDS VGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
    • Molecular weight37 kDa including tags
    • Amino acids801 to 900

Specifications

Our Abpromise guarantee covers the use of ab114215 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI608257
    • bHLHd2
    • Class D basic helix-loop-helix protein 2
    • OTTHUMP00000028740
    • Processed sterol regulatory element-binding protein 2
    • SRBP2_HUMAN
    • SREBF 2
    • Srebf2
    • SREBF2 protein
    • SREBP 2
    • SREBP-2
    • SREBP2
    • SREBP2gc
    • sterol regulatory element binding factor 2
    • Sterol regulatory element binding protein 2
    • Sterol regulatory element binding transcription factor 2
    • Sterol regulatory element-binding transcription factor 2
    see all
  • FunctionTranscriptional activator required for lipid homeostasis. Regulates transcription of the LDL receptor gene as well as the cholesterol and to a lesser degree the fatty acid synthesis pathway (By similarity). Binds the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3') found in the flanking region of the LDRL and HMG-CoA synthase genes.
  • Tissue specificityUbiquitously expressed in adult and fetal tissues.
  • Sequence similaritiesBelongs to the SREBP family.
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Post-translational
    modifications
    At low cholesterol the SCAP/SREBP complex is recruited into COPII vesicles for export from the ER. In the Golgi complex SREBPs are cleaved sequentially by site-1 and site-2 protease. The first cleavage by site-1 protease occurs within the luminal loop, the second cleavage by site-2 protease occurs within the first transmembrane domain and releases the transcription factor from the Golgi membrane. Apoptosis triggers cleavage by the cysteine proteases caspase-3 and caspase-7.
  • Cellular localizationNucleus and Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasmic vesicle > COPII-coated vesicle membrane. Moves from the endoplasmic reticulum to the Golgi in the absence of sterols.
  • Information by UniProt

Recombinant Human SREBP2 protein images

  • ab114215 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human SREBP2 protein (ab114215)

ab114215 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114215.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"