Recombinant Human SRGAP1 protein (ab163577)

Overview

  • Product name
    Recombinant Human SRGAP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PLDPETIAQDIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPT PATSTESLSPLHNVALRSSEPQIRRSTSSSSDTMSTFKPMVAPRMGVQL
    • Amino acids
      952 to 1050
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4930572H05Rik
    • ARHGAP13
    • FLJ22166
    • KIAA1304
    • RGD1566260
    • Rho GTPase activating protein 13
    • Rho GTPase-activating protein 13
    • SLIT ROBO Rho GTPase activating protein 1
    • SLIT-ROBO Rho GTPase-activating protein 1
    • SRGAP 1
    • srGAP1
    • SRGP1_HUMAN
    see all
  • Function
    GTPase-activating protein for RhoA and Cdc42 small GTPases. Together with CDC42 seems to be involved in the pathway mediating the repulsive signaling of Robo and Slit proteins in neuronal migration. SLIT2, probably through interaction with ROBO1, increases the interaction of SRGAP1 with ROBO1 and inactivates CDC42.
  • Tissue specificity
    Expressed in brain, lung, kidney, and testis.
  • Sequence similarities
    Contains 1 FCH domain.
    Contains 1 Rho-GAP domain.
    Contains 1 SH3 domain.
  • Domain
    The F-BAR domain mediates oligomerization, binds membranes, and constrains plasma membrane protrusions.
  • Information by UniProt

Images

  • ab163577 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up