Overview

  • Product nameRecombinant Human SRP14 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP37108
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMVLLESEQFLTELTRLFQKCRTSGSV YITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKK ISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAA PAAAATAATTAATTAATAAQ
    • Molecular weight17 kDa including tags
    • Amino acids1 to 160
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab101206 was purified by using conventional chromatography and is >85 % pure by SDS-PAGE.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 18 kDa Alu RNA binding protein
    • 18 kDa Alu RNA-binding protein
    • Alu RNA-binding protein, 14-KD subunit
    • ALURBP
    • MGC14326
    • Signal recognition particle 14 kDa protein
    • signal recognition particle 14kDa (homologous Alu RNA binding protein)
    • SRP 14
    • SRP14
    • SRP14_HUMAN
    see all
  • FunctionSignal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.
  • Sequence similaritiesBelongs to the SRP14 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SRP14 protein images

  • ab101206 (3 µg) analysed by 15% SDS PAGE.

References for Recombinant Human SRP14 protein (ab101206)

ab101206 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"