Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP09132
    • SpeciesHuman
    • SequenceMACTAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQ DVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPS RKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
    • Molecular weight42 kDa including tags
    • Amino acids1 to 144

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116802 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Signal recognition particle 19 kDa protein
    • signal recognition particle 19kDa
    • SRP19
    • SRP19_HUMAN
  • FunctionSignal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.
  • Sequence similaritiesBelongs to the SRP19 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human SRP19 protein images

  • 12.5% SDS-PAGE showing ab116802 at approximately 41.95kDa.
    Stained with Coomassie Blue.

References for Recombinant Human SRP19 protein (ab116802)

ab116802 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116802.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"