Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP61011
    • SpeciesHuman
    • SequenceMVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVK QLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGK
    • Molecular weight37 kDa including tags
    • Amino acids1 to 100

Specifications

Our Abpromise guarantee covers the use of ab116872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Signal recognition particle 54 kDa protein
    • Signal recognition particle 54kDa
    • SRP 54
    • SRP54
    • SRP54_HUMAN
    see all
  • FunctionBinds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
  • Sequence similaritiesBelongs to the GTP-binding SRP family.
  • DomainHas a two domain structure: the G-domain binds GTP; the M-domain binds the 7S RNA in presence of SRP19 and also binds the signal sequence.
  • Cellular localizationNucleus speckle. Cytoplasm.
  • Information by UniProt

Recombinant Human SRP54 protein images

  • 12.5% SDS-PAGE gel showing ab116872, at approximately 36.63kDa, stained with Coomassie Blue.

References for Recombinant Human SRP54 protein (ab116872)

ab116872 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"