Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVLADLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVK QLRENVKSAIDLEEMASGLNKRKMIQHAVFKELVKLVDPGVKAWTPTKGK
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab116872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Signal recognition particle 54 kDa protein
    • Signal recognition particle 54kDa
    • SRP 54
    • SRP54
    • SRP54_HUMAN
    see all
  • Function
    Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).
  • Sequence similarities
    Belongs to the GTP-binding SRP family.
  • Domain
    Has a two domain structure: the G-domain binds GTP; the M-domain binds the 7S RNA in presence of SRP19 and also binds the signal sequence.
  • Cellular localization
    Nucleus speckle. Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE gel showing ab116872, at approximately 36.63kDa, stained with Coomassie Blue.

References

ab116872 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116872.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up