Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AILDANDAHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPG FQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS
    • Amino acids
      531 to 627
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159579 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Signal recognition particle 68
    • Signal recognition particle 68 kDa
    • Signal recognition particle 68 kDa protein
    • signal recognition particle 68kD
    • Signal recognition particle 68kDa
    • signal recognition particle subunit SRP68
    • SRP 68
    • SRP68
    • SRP68_HUMAN
    see all
  • Function
    Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP68 binds the 7S RNA, SRP72 binds to this complex subsequently. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.
  • Sequence similarities
    Belongs to the SRP68 family.
  • Domain
    The RNA-binding domain is located near the N-terminus.
  • Cellular localization
    Cytoplasm. Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab159579 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159579 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159579.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up