Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15532
    • SpeciesHuman
    • SequenceMSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQY QQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPR SHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSM NMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQP NQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQI PPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGY QQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQ QYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQP PQQRPYGYDQGQYGNYQ
    • Molecular weight72 kDa including tags
    • Amino acids1 to 418

Specifications

Our Abpromise guarantee covers the use of ab116825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC116875
    • Protein SSXT
    • Protein SYT
    • SS18
    • SSXT
    • SSXT/SSX4v fusion
    • SSXT_HUMAN
    • Synovial sarcoma translocated to X chromosome
    • Synovial sarcoma translocated to X chromosome protein
    • Synovial sarcoma translocation chromosome 18
    • SYT
    • SYT SSX1
    • SYT SSX2
    • SYT/SSX4v fusion protein
    • SYTSSX1
    • SYTSSX2
    see all
  • FunctionAppears to function synergistically with RBM14 as a transcriptional coactivator. Isoform 1 and isoform 2 function in nuclear receptor coactivation. Isoform 1 and isoform 2 function in general transcriptional coactivation.
  • Tissue specificityFairly ubiquitously expressed. Expressed in synovial sarcomas and in other human cell lines. The fusion genes SSXT-SSX1 and SSXT-SSX2 are expressed only in synovial sarcomas.
  • Involvement in diseaseNote=A chromosomal aberration involving SS18 may be a cause of synovial sarcoma. Translocation t(X;18)(p11.2;q11.2). The translocation is specifically found in more than 80% of synovial sarcoma. The fusion products SSXT-SSX1 or SSXT-SSX2 are probably responsible for transforming activity. Heterogeneity in the position of the breakpoint can occur (low frequency).
  • Sequence similaritiesBelongs to the SS18 family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SS18 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116825 at approximately 72.05 kDa.

References for Recombinant Human SS18 protein (ab116825)

ab116825 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"