Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ04837
    • SpeciesHuman
    • SequenceMFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEG KNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQ YVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
    • Molecular weight42 kDa including tags
    • Amino acids1 to 148
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • mitochondrial
    • Mt SSB
    • Mt-SSB
    • MtSSB
    • PWP1 interacting protein 17
    • PWP1-interacting protein 17
    • SENSOR OF SINGLE-STRANDED DNA COMPLEX
    • Single stranded DNA binding protein
    • Single stranded DNA binding protein 1
    • Single stranded DNA binding protein mitochondrial
    • Single-stranded DNA-binding protein
    • SOSS B1
    • SOSS COMPLEX, SUBUNIT B1
    • SSBP
    • SSBP 1
    • SSBP_HUMAN
    • SSBP1
    see all
  • FunctionThis protein binds preferentially and cooperatively to ss-DNA. Probably involved in mitochondrial DNA replication.
  • Sequence similaritiesContains 1 SSB domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human SSBP1 protein images

  • ab112355 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human SSBP1 protein (ab112355)

ab112355 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"