Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEG KNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQ YVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKEKE
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 148
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • mitochondrial
    • Mt SSB
    • Mt-SSB
    • MtSSB
    • PWP1 interacting protein 17
    • PWP1-interacting protein 17
    • SENSOR OF SINGLE-STRANDED DNA COMPLEX
    • Single stranded DNA binding protein
    • Single stranded DNA binding protein 1
    • Single stranded DNA binding protein mitochondrial
    • Single-stranded DNA-binding protein
    • SOSS B1
    • SOSS COMPLEX, SUBUNIT B1
    • SSBP
    • SSBP 1
    • SSBP_HUMAN
    • SSBP1
    see all
  • Function
    This protein binds preferentially and cooperatively to ss-DNA. Probably involved in mitochondrial DNA replication.
  • Sequence similarities
    Contains 1 SSB domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab112355 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up