Overview

  • Product nameRecombinant Human Ssu72 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NP77
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMPSSPLRVAVVCSSNQNRSMEAHNILS KRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTYDQMYNDLLRKDKELYT QNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEERVYDQVVEDLNSRE QETCQPVHVVNVDIQDNHEEATLGAFLICELCQCIQHTEDMENEIDELLQ EFEEKSGRTFLHTVCFY
    • Molecular weight25 kDa including tags
    • Amino acids1 to 194
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab123148 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • CTD phosphatase SSU72
    • HSPC182
    • Hypothetical protein FLJ10947
    • PNAS-120
    • RNA polymerase II subunit A C-terminal domain phosphatase SSU72
    • ssu72
    • Ssu72 RNA polymerase II CTD phosphatase homolog
    • Ssu72 RNA polymerase II CTD phosphatase homolog (yeast)
    • SSU72_HUMAN
    see all
  • FunctionMay be involved in the C-terminal domain of RNA polymerase II dephosphorylation, RNA processing and termination.
  • Sequence similaritiesBelongs to the SSU72 phosphatase family.
  • Cellular localizationNucleus. Cytoplasm. Predominantly in the cytosol.
  • Information by UniProt

Recombinant Human Ssu72 protein images

  • 15% SDS PAGE, 3 µg of ab123148 loaded.

References for Recombinant Human Ssu72 protein (ab123148)

ab123148 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"