Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16384
    • SpeciesHuman
    • SequenceNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQ LHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE
    • Molecular weight37 kDa including tags
    • Amino acids89 to 188

Specifications

Our Abpromise guarantee covers the use of ab116788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 5.1
    • Cancer/testis antigen family 5 member 1
    • CT5.1
    • MGC150425
    • MGC5162
    • Protein SSX1
    • sarcoma, synovial, X chromosome related 1
    • SSRC
    • SSX1
    • SSX1_HUMAN
    • Synovial sarcoma
    • Synovial sarcoma, X breakpoint 1
    • X breakpoint 1
    see all
  • FunctionCould act as a modulator of transcription.
  • Tissue specificityExpressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and epithelial cell lines.
  • Involvement in diseaseNote=A chromosomal aberration involving SSX1 may be a cause of synovial sarcoma. Translocation t(X;18)(p11.2;q11.2). The translocation is specifically found in more than 80% of synovial sarcoma. The fusion products SSXT-SSX1 or SSXT-SSX2 are probably responsible for transforming activity. Heterogeneity in the position of the breakpoint can occur (low frequency).
  • Sequence similaritiesBelongs to the SSX family.
    Contains 1 KRAB-related domain.
  • Information by UniProt

Recombinant Human SSX1 protein images

  • 12.5% SDS-PAGE showing ab116788 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human SSX1 protein (ab116788)

ab116788 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"