Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16385
    • SpeciesHuman
    • SequenceMNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVY MKRKYEAMTKLGFKATLPPFMCNKRAEDFQGNDLDNDPNRGNQVERPQMT FGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEK IHERSGNREAQEKEERRGTAHRWSSQNTHNIGRFSLSTSMGAVHGTPKTI THNRDPKGGNMPGPTDCVRENSW
    • Molecular weight51 kDa including tags
    • Amino acids1 to 223

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116849 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 5.2
    • Cancer/testis antigen family 5, member 2a
    • Cancer/testis antigen family 5, member 2b
    • CT5.2
    • CT5.2A
    • CT5.2b
    • HD21
    • hom mel 40
    • HOM-MEL-40
    • MGC119055
    • MGC15364
    • MGC3884
    • Protein SSX2
    • RP11-552J9.2
    • sarcoma, synovial, X-chromosome related 2
    • SSx
    • SSX2
    • SSX2-SYT fusion gene, included
    • SSX2_HUMAN
    • SSX2B
    • Synovial sarcoma
    • synovial sarcoma X breakpoint 2
    • Synovial sarcoma, X breakpoint 2B
    • Tumor antigen HOM-MEL-40
    • X breakpoint 2
    see all
  • FunctionCould act as a modulator of transcription.
  • Tissue specificityExpressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and epithelial cell lines.
  • Involvement in diseaseNote=A chromosomal aberration involving SSX2 may be a cause of synovial sarcoma. Translocation t(X;18)(p11.2;q11.2). The translocation is specifically found in more than 80% of synovial sarcoma. The fusion products SSXT-SSX1 or SSXT-SSX2 are probably responsible for transforming activity. Heterogeneity in the position of the breakpoint can occur (low frequency).
  • Sequence similaritiesBelongs to the SSX family.
    Contains 1 KRAB-related domain.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human SSX2 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116849 at approximately 50.64 kDa.

References for Recombinant Human SSX2 protein (ab116849)

ab116849 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116849.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"