Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9Y5Y6
    • SpeciesHuman
    • SequencePPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKA QGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTC PKD
    • Molecular weight37 kDa including tags
    • Amino acids298 to 400

Specifications

Our Abpromise guarantee covers the use of ab114598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Epithin
    • HAI
    • Matriptase
    • Membrane type serine protease
    • Membrane type serine protease 1
    • Membrane-type serine protease 1
    • MT SP1
    • MT-SP1
    • MTSP 1
    • MTSP1
    • Prostamin
    • PRSS 14
    • PRSS14
    • Serine protease 14
    • Serine protease TADG 15
    • Serine protease TADG-15
    • Serine protease TADG15
    • SNC 19
    • SNC19
    • ST 14
    • ST14
    • ST14_HUMAN
    • Suppression of tumorigenicity 14
    • Suppression of tumorigenicity 14 (colon carcinoma matriptase epithin)
    • Suppression of tumorigenicity 14 (colon carcinoma)
    • Suppressor of tumorigenicity 14 protein
    • Suppressor of tumorigenicity protein 14
    • TADG 15
    • TADG15
    • TMPRSS14
    • Tumor associated differentially expressed gene 15 protein
    • Tumor-associated differentially-expressed gene 15 protein
    see all
  • FunctionDegrades extracellular matrix. Proposed to play a role in breast cancer invasion and metastasis. Exhibits trypsin-like activity as defined by cleavage of synthetic substrates with Arg or Lys as the P1 site.
  • Involvement in diseaseDefects in ST14 are a cause of ichthyosis autosomal recessive with hypotrichosis (ARIH) [MIM:610765]. ARIH is a skin disorder characterized by congenital ichthyosis associated with the presence of less than the normal amount of hair.
  • Sequence similaritiesBelongs to the peptidase S1 family.
    Contains 2 CUB domains.
    Contains 4 LDL-receptor class A domains.
    Contains 1 peptidase S1 domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human ST14 protein images

  • ab114598 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human ST14 protein (ab114598)

ab114598 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"