Recombinant Human ST3GAL5 protein (ab160231)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPSEYTYVKLRSDCSRPSLQWYTRAQSKMRRPSLLLKDILKCTLLVFGVW ILYILKLNYTTEECDMKKMHYVDPDRVKRAQKYAQQVLQKECRPKFAKTS MALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQTLLELL PEHDLPEHLKAKTCRRCVVIGSGGILHGLELGHTLNQFDVVIRLNSAPVE GYSEHVGNKTTIRMTYPEGAPLSDLEYYSNDLFVAVLFKSVDFNWLQAMV KKETLPFWVRLFFWKQVAEKIPLQPKHFRILNPVIIKETAFDILQYSEPQ SRFWGRDKNVPTIGVIAVVLATHLCDEVSLAGFGYDLNQPRTPLHYFDSQ CMAAMNFQTMHNVTTETKFLLKLVKEGVVKDLSGGIDREF
    • Amino acids
      1 to 390
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3-sialyltransferase
    • CMP-NeuAc:lactosylceramide alpha-2
    • CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase
    • EC 2.4.99.9
    • Ganglioside GM3 synthase
    • Lactosylceramide alpha-2,3-sialyltransferase
    • Sialyltransferase 9
    • SIAT9
    • SIAT9_HUMAN
    • SIATGM3S
    • ST3 beta-galactoside alpha-2,3-sialyltransferase 5
    • ST3GAL
    • ST3Gal V
    • ST3GAL5
    • ST3GalV
    see all
  • Function
    Catalyzes the formation of ganglioside GM3 (alpha-N-acetylneuraminyl-2,3-beta-D-galactosyl-1, 4-beta-D-glucosylceramide).
  • Tissue specificity
    Ubiquitous. High expression in brain, skeletal muscle, placenta, and testis.
  • Involvement in disease
    Defects in ST3GAL5 are the cause of Amish infantile epilepsy syndrome (AIES) [MIM:609056]. AIES is an autosomal recessive, infantile-onset symptomatic epilepsy associated with developmental stagnation and blindness.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Post-translational
    modifications
    N-glycosylated.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab160231 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up