Overview

  • Product name
    Recombinant Human ST4S6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSK QMNLLAVLEVRTEGNENWGGFLRFKKGKRCSLVFGLIIMTLVMASYILSG AHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYP SIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCW YEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRL RCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRL RDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASAS TMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYS DYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPV RLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGP LSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQV LADEAFAWKTT
    • Amino acids
      1 to 561
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B cell RAG associated gene protein
    • B cell RAG associated protein
    • B cell RAG associated protein (GALNAC4S 6ST)
    • BRAG
    • Carbohydrate sulfotransferase 15
    • CHST15
    • GALNAC4S 6ST
    • hBRAG
    • KIAA0598
    • N acetylgalactosamine 4 sulfate 6 O sulfotransferase
    see all
  • Relevance
    ST4S6 is a membrane-integrated glycoprotein that is expressed as a disulfide-linked dimer in B cells. It may act as a B-cell receptor involved in BCR ligation-mediated early activation, which mediates regulatory signals key to B-cell development and/or regulation of B-cell-specific RAG expression, however such results are unclear in vivo.
  • Cellular localization
    Golgi apparatus membrane; Single-pass type II membrane protein. Note= A small fraction may also be present at the cell surface, where it acts as a B-cell receptor.

Images

  • ab162523 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162523 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up