Recombinant Human ST6GALNAC1 protein (ab163235)

Overview

  • Product name
    Recombinant Human ST6GALNAC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SRHQRTENIKERSLQSLAKPKSQAPTRARRTTIYAEPVPENNALNTQTQP KAHTTGDRGKEANQAPPEEQDKVPHTAQRAAWKSPEKEKT
    • Amino acids
      43 to 132
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163235 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 6-sialyltransferase 1
    • 6-sialyltransferase I
    • Alpha N acetylgalactosaminide alpha 2 6 sialyltransferase
    • Alpha N acetylgalactosaminide alpha 2 6 sialyltransferase 1
    • Alpha-N-acetylgalactosaminide alpha-2
    • GalNAc alpha 2 6 sialyltransferase I
    • GalNAc alpha-2
    • HSY11339
    • SIA7A_HUMAN
    • Sialyltransferase 7A
    • SIAT7-A
    • SIAT7A
    • ST6 (alpha N acetyl neuraminyl 2 3 beta galactosyl 1 3) N acetylgalactosaminide alpha 2 6 sialyltransferase 1
    • ST6GalNAc I
    • ST6GALNAC1
    • ST6GalNAcI
    • STYI
    see all
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab163235 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163235 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163235.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up