Overview

  • Product name
    Recombinant Human ST7 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLST VSMFLNTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSH LRPLLGGVDNNSSNNSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGR EPLTYYDMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAH EALEINECATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHH GSQYEAQHRRDTNVLVYIKRRLAMCARRLGRTREAVKMMRDLMKEFPLLS MFNIHENLLEALLELQAYADVQAVLAKYDDISLPKSATICYTAALLKARA VSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYLLEMKSLILPP EHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLA LLTHQFPELMGVFAKAFLSTLFAPLNFVMEKVESILPSSLWHQLTRI
    • Amino acids
      1 to 547
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159920 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ETS7q
    • FAM4A
    • FAM4A1
    • Family with sequence similarity 4, subfamily A, member 1
    • HELG
    • Protein FAM4A1
    • Protein HELG
    • RAY1
    • SEN4
    • ST7
    • ST7_HUMAN
    • Suppression of tumorigenicity 7
    • Suppression of tumorigenicity 7 (breast)
    • Suppressor of tumorigenicity 7 protein
    • TSG7
    see all
  • Function
    May act as a tumor suppressor.
  • Tissue specificity
    Ubiquitously expressed, with highest levels in heart, liver and pancreas.
  • Sequence similarities
    Belongs to the ST7 family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159920 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159920 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159920.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up