Recombinant Human ST8SIA1 protein (ab116781)

Overview

  • Product name
    Recombinant Human ST8SIA1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGE FLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEAN
    • Molecular weight
      37 kDa including tags
    • Amino acids
      61 to 160

Specifications

Our Abpromise guarantee covers the use of ab116781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 8-sialyltransferase
    • 8-sialyltransferase 8A
    • Alpha 2,8 sialyltransferase 8A
    • Alpha N acetylneuraminide alpha 2,8 sialyltransferase
    • Alpha-2
    • Alpha-N-acetylneuraminide alpha-2
    • Disialoganglioside (GD3) synthase
    • Ganglioside GD3 synthase
    • Ganglioside GT3 synthase
    • Ganglioside specific alpha 2,8 polysialyltransferase
    • GD3S
    • SIA8A_HUMAN
    • Sialyltransferase 8 (alpha N acetylneuraminate: alpha 2,8 sialytransferase, GD3 synthase) A
    • Sialyltransferase 8A
    • Sialyltransferase 8A (alpha N acetylneuraminate: alpha 2,8 sialyltransferase, GD3 synthase)
    • Sialytransferase St8Sia I
    • SIAT8
    • SIAT8-A
    • SIAT8A
    • ST8 alpha N acetyl neuraminide alpha 2,8 sialyltransferase 1
    • ST8 alpha N acetyl neuraminide alpha 28 sialyltransferase 1
    • ST8Sia I
    • ST8SIA1
    • ST8SiaI
    see all
  • Function
    Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid.
  • Tissue specificity
    Strongly expressed in melanoma cell lines, adult and fetal brain and to a lesser extent in adult and fetal lung.
  • Pathway
    Protein modification; protein glycosylation.
    Lipid metabolism; sphingolipid metabolism.
  • Sequence similarities
    Belongs to the glycosyltransferase 29 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Recombinant Human ST8SIA1 protein images

  • 12.5% SDS-PAGE showing ab116781 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human ST8SIA1 protein (ab116781)

ab116781 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up