Recombinant Human stabilin1 protein (ab161555)

Overview

  • Product name
    Recombinant Human stabilin1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFE GGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ
    • Amino acids
      1804 to 1902
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161555 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CLEVER 1
    • Common lymphatic endothelial and vascular endothelial receptor 1
    • EGF-like
    • Fasciclin
    • Fasciclin EGF like laminin type EGF like and link domain containing scavenger receptor 1
    • fasciclin egf-like
    • FEEL 1
    • FEEL-1
    • FELE 1
    • FEX1
    • KIAA0246
    • laminin-type EGF-like and link domain-containing scavenger receptor 1
    • MS 1 antigen
    • MS-1 antigen
    • STAB 1
    • Stab1
    • STAB1_HUMAN
    • Stabilin-1
    see all
  • Function
    Acts as a scavenger receptor for acetylated low density lipoprotein. Binds to both Gram-positive and Gram-negative bacteria and may play a role in defense against bacterial infection. When inhibited in endothelial tube formation assays, there is a marked decrease in cell-cell interactions, suggesting a role in angiogenesis. Involved in the delivery of newly synthesized CHID1/SI-CLP from the biosynthetic compartment to the endosomal/lysosomal system.
  • Tissue specificity
    High levels found in spleen, lymph node, liver and placenta. Also expressed in endothelial cells.
  • Sequence similarities
    Contains 16 EGF-like domains.
    Contains 7 FAS1 domains.
    Contains 2 laminin EGF-like domains.
    Contains 1 Link domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab161555 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161555 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161555.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up