Recombinant Human STAC protein (denatured) (ab180301)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMIPPSSPREDGVDGLPKEAVGAEQPPS PASTSSQESKLQKLKRSLSFKTKSLRSKSADNFFQRTNSEDMKLQAHMVA EISPSSSPLPAPGSLTSTPARAGLHPGGKAHAFQEYIFKKPTFCDVCNHM IVGTNAKHGLRCKACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPLLI HEQFGCIKEVMPIACGNKVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHR TSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQ GSLSKDPLQMNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKI QDRIGFFPANFVQRLQQNEKIFRCVRTFIGCKEQGQITLKENQICVSSEE EQDGFIRVLSGKKKGLIPLDVLENI
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 402
    • Tags
      His tag N-Terminus
    • Additional sequence information
      Protein accession number; NP_003140.

Specifications

Our Abpromise guarantee covers the use of ab180301 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names
    • FLJ32331
    • SH3 and cysteine rich domain
    • SH3 and cysteine rich domain containing protein
    • SH3 and cysteine-rich domain-containing protein
    • SRC homology 3 and cysteine rich domain protein
    • Src homology 3 and cysteine-rich domain-containing protein
    • Src homology three (SH3) and cysteine rich domain
    • STAC
    • STAC 1
    • STAC_HUMAN
    • STAC1
    see all
  • Function
    Probably involved in a neuron-specific signal transduction.
  • Sequence similarities
    Contains 1 phorbol-ester/DAG-type zinc finger.
    Contains 1 SH3 domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180301 (3µg).

References

ab180301 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180301.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up