Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSI MRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKG HPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAA EQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPS TSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKG ETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVS GSQVYAGPPPSGAYLVAGNAQMSHLQSYSLPPEQLSSLSQAVVPPSANPA LPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAAATADVTLYQN AGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
    • Molecular weight
      59 kDa
    • Amino acids
      1 to 540

Specifications

Our Abpromise guarantee covers the use of ab188708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Binds AMSH protein with Kd = ~7 μM. In in vitro assays containing 200 nM AMSH, a ~10-fold increase in the rate of hydrolysis of K63-linked diubiquitin FRET substrate was achieved upon the addition of STAM1. Half-maximal increase occurred at 0.4 μM STAM1.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 1.19% HEPES, 1.16% Sodium chloride, 0.03% DTT, 0.06% EDTA

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • HSE1 homolog
    • Signal transducing adapter molecule 1
    • signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
    • STAM
    • STAM-1
    • STAM1_HUMAN
    see all
  • Function
    Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the STAM family.
    Contains 1 ITAM domain.
    Contains 1 SH3 domain.
    Contains 1 UIM (ubiquitin-interacting motif) repeat.
    Contains 1 VHS domain.
  • Post-translational
    modifications
    Phosphorylated on Tyr-198. Phosphorylated in response to IL2, IL3, IL4, IL7, CSF2/GM-CSF, EGF and PDGFB. Phosphorylated by activated PDGFRB.
  • Cellular localization
    Cytoplasm. Early endosome membrane.
  • Information by UniProt

References

ab188708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up