Overview

  • Product name
    Recombinant Human STAP2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYF YNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRDQEIKFKV ETLECREMWK
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BKS
    • Breast tumor kinase substrate
    • Brk kinase substrate
    • BRK substrate
    • Signal transducing adaptor protein 2
    • Signal-transducing adaptor protein 2
    • Ssignal transducing adaptor family member 2
    • STAP 2
    • STAP-2
    • STAP2
    • STAP2_HUMAN
    see all
  • Function
    Substrate of protein kinase PTK6. May play a regulatory role in the acute-phase response in systemic inflammation and may modulate STAT3 activity.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 1 PH domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine. Tyr-250 may be important for interaction with kinases. Tyr-22 and Tyr-322 appears to be phosphorylated by SRC.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163151 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up