Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49675
    • SpeciesHuman
    • SequenceMLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWIN QVRRRSSLLGSRLEETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKES QQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVERMEAMGEWNPN VKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKRRGSTCVLA GMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDLKGW LPKSIINQVLSQTQVDFANHLRKRLESHPASEARC
    • Molecular weight57 kDa including tags
    • Amino acids1 to 286

Specifications

Our Abpromise guarantee covers the use of ab114371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cholesterol trafficker
    • Luteinizing hormone induced protein
    • mitochondrial
    • Mitochondrial steroid acute regulatory protein
    • StAR
    • StAR related lipid transfer (START) domain containing 1
    • STAR_HUMAN
    • StARD1
    • START domain containing 1
    • START domain containing protein 1
    • START domain-containing protein 1
    • Steroid acute regulatory protein
    • Steroidogenic acute regulator
    • Steroidogenic acute regulatory protein
    • Steroidogenic acute regulatory protein mitochondrial
    see all
  • FunctionPlays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Mediates the transfer of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane where it is cleaved to pregnenolone.
  • Tissue specificityExpressed in gonads, adrenal cortex and kidney.
  • PathwaySteroid metabolism; cholesterol metabolism.
  • Involvement in diseaseDefects in STAR are the cause of adrenal hyperplasia type 1 (AH1) [MIM:201710]. The most severe form of adrenal hyperplasia. It is a condition characterized by onset of profound adrenocortical insufficiency shortly after birth, hyperpigmentation reflecting increased production of pro-opiomelanocortin, elevated plasma renin activity as a consequence of reduced aldosterone synthesis, and male pseudohermaphroditism resulting from deficient fetal testicular testosterone synthesis. Affected individuals are phenotypic females irrespective of gonadal sex, and frequently die in infancy if mineralocorticoid and glucocorticoid replacement are not instituted.
  • Sequence similaritiesContains 1 START domain.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human StAR protein images

  • 12.5% SDS-PAGE showing ab114371 at approximately 57.46kDa stained with Coomassie Blue.

References for Recombinant Human StAR protein (ab114371)

ab114371 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"