Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEETLYSDQELAYLQQGEEAMQKALGILSN QEGWKKESQQDNGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVERME AMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVGPRDFVSVRCAKR RGSTCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLTWL LSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASEARC
    • Molecular weight
      27 kDa including tags
    • Amino acids
      64 to 285
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115707 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab115707 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.03% DTT

General Info

  • Alternative names
    • Cholesterol trafficker
    • Luteinizing hormone induced protein
    • mitochondrial
    • Mitochondrial steroid acute regulatory protein
    • StAR
    • StAR related lipid transfer (START) domain containing 1
    • STAR_HUMAN
    • StARD1
    • START domain containing 1
    • START domain containing protein 1
    • START domain-containing protein 1
    • Steroid acute regulatory protein
    • Steroidogenic acute regulator
    • Steroidogenic acute regulatory protein
    • Steroidogenic acute regulatory protein mitochondrial
    see all
  • Function
    Plays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Mediates the transfer of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane where it is cleaved to pregnenolone.
  • Tissue specificity
    Expressed in gonads, adrenal cortex and kidney.
  • Pathway
    Steroid metabolism; cholesterol metabolism.
  • Involvement in disease
    Defects in STAR are the cause of adrenal hyperplasia type 1 (AH1) [MIM:201710]. The most severe form of adrenal hyperplasia. It is a condition characterized by onset of profound adrenocortical insufficiency shortly after birth, hyperpigmentation reflecting increased production of pro-opiomelanocortin, elevated plasma renin activity as a consequence of reduced aldosterone synthesis, and male pseudohermaphroditism resulting from deficient fetal testicular testosterone synthesis. Affected individuals are phenotypic females irrespective of gonadal sex, and frequently die in infancy if mineralocorticoid and glucocorticoid replacement are not instituted.
  • Sequence similarities
    Contains 1 START domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab115707 at approximately 27.1kDa (3µg).

References

ab115707 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115707.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up