Recombinant Human STARD5 protein (ab164289)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNL YRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSR TSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVR GFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRF YANLQKAVKQFHE
    • Amino acids
      1 to 213
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164289 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC10327
    • StAR related lipid transfer protein 5
    • StAR-related lipid transfer (START) domain containing 5
    • StARD5
    • START domain containing 5
    • START domain containing protein 5
    see all
  • Relevance
    STARD5, or START domain containing 5, belongs to a family containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain. STARD5 may be involved in the intracellular transport of sterols or other lipids and may bind cholesterol or other sterols.
  • Cellular localization
    Cytoplasmic

Images

  • ab164289 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164289 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164289.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up