Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKP PKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRG MYNQRYHCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQNE PIPERSPQNGESGKDMDDDKDANKSEISLVFEIALKRNMPVSFEVIKESG PPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVE KPKLFFKKRPKTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSER GMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQ DQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVIS GTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNGTSSTAEAIGL KGSSPTPPCSPVQPSKQLEYLARIQGFQV
    • Amino acids
      1 to 479
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 39K2
    • 39K3
    • DKFZp781K0371
    • Double stranded RNA binding protein Staufen homolog 2
    • Double-stranded RNA-binding protein Staufen homolog 2
    • MGC119606
    • STAU 2
    • stau2
    • STAU2_HUMAN
    • Staufen (Drosophila, RNA-binding protein) homolog 2
    • Staufen double-stranded RNA binding protein 2
    • Staufen homolog 2
    • Staufen RNA binding protein homolog 2
    • Staufen, RNA binding protein, homolog 2 (Drosophila)
    see all
  • Function
    RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body.
  • Sequence similarities
    Contains 4 DRBM (double-stranded RNA-binding) domains.
  • Domain
    The DRBM 3 domain appears to be the major RNA-binding determinant. This domain also mediates interaction with XPO5 and is required for XPO1/CRM1-independent nuclear export.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus > nucleolus. Endoplasmic reticulum. Shuttles between the nucleolus, nucleus and the cytoplasm. Nuclear export of isoform 1 is independent of XPO1/CRM1 and requires the exportin XPO5. Nuclear export of isoform 2 and isoform 3 can occur by both XPO1/CRM1-dependent and XPO1/CRM1-independent pathways. Found in large cytoplasmic ribonucleoprotein (RNP) granules which are present in the actin rich regions of myelinating processes and associated with microtubules, polysomes and the endoplasmic reticulum. Also recruited to stress granules (SGs) upon inhibition of translation or oxidative stress. These structures are thought to harbor housekeeping mRNAs when translation is aborted.
  • Information by UniProt

Images

  • ab162064 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up