Overview

  • Product name
    Recombinant Human STCH protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSELEMQQYLPLPTPK VIGIDLGTTYCSVGVFFPGTGKVKVIPDENGHISIPSMVSFTDNDVYVGY ESVELADSNPQNTIYDAKRFIGKIFTAEELEAEIGRYPFKVLNKNGMVEF SVTSNETITVSPEYVGSRLLLKLKEMAEAYLGMPVANAVISVPAEFDLKQ RNSTIEAANLAGLKILRVINEPTAAAMAYGLHKADVFHVLVIDLGGGTLD VSLLNKQGGMFLTRAMSGNNKLGGQDFNQRLLQYLYKQIYQTYGFVPSRK EEIHRLRQAVEMVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDK LSSADDHRVNSGFGRGLSDKKSGESQVLFETEISRKLFDTLNEDLFQKIL VPIQQVLKEGHLEKTEIDEVVLVGGSTRIPRIRQVIQEFFGKDPNTSVDP DLAVVTGVAIQAGIDGGFWPLQVSALEIPNKHLQKTNFN
    • Molecular weight
      54 kDa including tags
    • Amino acids
      23 to 471
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab104640 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Heat shock 70 kDa protein 13
    • HEAT SHOCK 70-KD PROTEIN 13
    • heat shock protein 70kDa family, member 13
    • heat shock protein70kDa family, member13
    • HSP13_HUMAN
    • HSPA13
    • MGC133835
    • Microsomal stress 70 protein ATPase core
    • Microsomal stress-70 protein ATPase core
    • STCH
    • Stress 70 protein chaperone microsome associated 60 kDa protein
    • Stress-70 protein chaperone microsome-associated 60 kDa protein
    see all
  • Function
    Has peptide-independent ATPase activity.
  • Tissue specificity
    Constitutively expressed in all tissues.
  • Sequence similarities
    Belongs to the heat shock protein 70 family.
  • Cellular localization
    Microsome. Endoplasmic reticulum.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab104640.

References

ab104640 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up