Recombinant Human Stella protein (denatured) (ab134623)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMDPSQFNPTYIPGSPQMLTEENSRDDS GASQISSETLIKNLSNLTINASSESVSPLSEALLRRESVGAAVLREIEDE WLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPKGVKKESR PFKCPCSFCVSNGWDPSENARIGNQDTKPLQP
    • Molecular weight
      20 kDa including tags
    • Amino acids
      1 to 159
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • Compaction associated protein 1
    • Developmental pluripotency associated 3
    • Developmental pluripotency associated protein 3
    • Developmental pluripotency-associated protein 3
    • Dppa3
    • DPPA3_HUMAN
    • PGC7
    • Stella related protein
    • Stella-related protein
    see all
  • Function
    May play a role in maintaining cell pluripotentiality.
  • Tissue specificity
    Low expression in testis, ovary and thymus. Expressed in embryonic stem and carcinoma cells. Highly expressed in testicular germ cell tumors.
  • Developmental stage
    Expressed in fetal ovary.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134623.

References

ab134623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up