Recombinant Human Sterol carrier protein 2 (ab117049)

Overview

  • Product name
    Recombinant Human Sterol carrier protein 2
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKK IGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDF LALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 143

Specifications

Our Abpromise guarantee covers the use of ab117049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686C12188
    • DKFZp686D11188
    • NLTP
    • NLTP_HUMAN
    • Non-specific lipid-transfer protein
    • Nonspecific lipid transfer protein
    • NSL TP
    • NSL-TP
    • OTTHUMP00000010488
    • OTTHUMP00000231766
    • OTTHUMP00000231767
    • OTTHUMP00000231768
    • OTTHUMP00000231769
    • OTTHUMP00000231770
    • OTTHUMP00000231772
    • OTTHUMP00000231773
    • OTTHUMP00000231774
    • OTTHUMP00000231776
    • OTTHUMP00000234662
    • Propanoyl CoA C acyltransferase
    • Propanoyl-CoA C-acyltransferase
    • SCP 2
    • SCP chi
    • SCP X
    • SCP-2
    • SCP-chi
    • SCP-X
    • SCP2
    • SCPchi
    • SCPX
    • Sterol carrier protein 2
    • Sterol carrier protein X
    see all
  • Function
    Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.
  • Tissue specificity
    Liver, fibroblasts, and placenta.
  • Involvement in disease
    Defects in SCP2 are a cause of leukoencephalopathy with dystonia and motor neuropathy (LDMN) [MIM:613724]; also known as sterol carrier protein 2 deficiency. LDMN is a syndrome characterized by leukoencephalopathy, dystonic head tremor, spasmodic torticollis and reduced tendon reflexes in lower extremities. Additional features include hyposmia, pathologic saccadic eye movements, a slight hypoacusis, accumulation of branched-chain pristanic acid in plasma, and the presence of abnormal bile alcohol glucuronides in urine.
  • Sequence similarities
    In the N-terminal section; belongs to the thiolase family.
    Contains 1 SCP2 domain.
  • Cellular localization
    Mitochondrion; Cytoplasm. Mitochondrion. Cytoplasmic in the liver and also associated with mitochondria especially in steroidogenic tissues and Peroxisome. Interaction with PEX5 is essential for peroxisomal import.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117049 at approximately 41.84 kDa.
    Stained with Coomassie Blue.

References

ab117049 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117049.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up