Recombinant Human Sterol carrier protein 2 (ab117049)

Overview

  • Product nameRecombinant Human Sterol carrier protein 2
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP22307-2
    • SpeciesHuman
    • SequenceMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKK IGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDF LALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL
    • Molecular weight42 kDa including tags
    • Amino acids1 to 143

Specifications

Our Abpromise guarantee covers the use of ab117049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686C12188
    • DKFZp686D11188
    • NLTP
    • NLTP_HUMAN
    • Non-specific lipid-transfer protein
    • Nonspecific lipid transfer protein
    • NSL TP
    • NSL-TP
    • OTTHUMP00000010488
    • OTTHUMP00000231766
    • OTTHUMP00000231767
    • OTTHUMP00000231768
    • OTTHUMP00000231769
    • OTTHUMP00000231770
    • OTTHUMP00000231772
    • OTTHUMP00000231773
    • OTTHUMP00000231774
    • OTTHUMP00000231776
    • OTTHUMP00000234662
    • Propanoyl CoA C acyltransferase
    • Propanoyl-CoA C-acyltransferase
    • SCP 2
    • SCP chi
    • SCP X
    • SCP-2
    • SCP-chi
    • SCP-X
    • SCP2
    • SCPchi
    • SCPX
    • Sterol carrier protein 2
    • Sterol carrier protein X
    see all
  • FunctionMediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.
  • Tissue specificityLiver, fibroblasts, and placenta.
  • Involvement in diseaseDefects in SCP2 are a cause of leukoencephalopathy with dystonia and motor neuropathy (LDMN) [MIM:613724]; also known as sterol carrier protein 2 deficiency. LDMN is a syndrome characterized by leukoencephalopathy, dystonic head tremor, spasmodic torticollis and reduced tendon reflexes in lower extremities. Additional features include hyposmia, pathologic saccadic eye movements, a slight hypoacusis, accumulation of branched-chain pristanic acid in plasma, and the presence of abnormal bile alcohol glucuronides in urine.
  • Sequence similaritiesIn the N-terminal section; belongs to the thiolase family.
    Contains 1 SCP2 domain.
  • Cellular localizationMitochondrion; Cytoplasm. Mitochondrion. Cytoplasmic in the liver and also associated with mitochondria especially in steroidogenic tissues and Peroxisome. Interaction with PEX5 is essential for peroxisomal import.
  • Information by UniProt

Recombinant Human Sterol carrier protein 2 images

  • 12.5% SDS-PAGE showing ab117049 at approximately 41.84 kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Sterol carrier protein 2 (ab117049)

ab117049 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117049.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"