Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFP ESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAA K
    • Amino acids
      365 to 465
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153177 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • NDR
    • NDR 1
    • Ndr Ser/Thr kinase-like protein
    • NDR1
    • NDR1 protein kinase
    • Nuclear Dbf2 related kinase 1
    • nuclear Dbf2-related 1
    • Nuclear Dbf2-related kinase 1
    • Nuclear Dbf2-related protein
    • Serine/threonine protein kinase 38
    • Serine/threonine-protein kinase 38
    • STK 38
    • STK38
    • STK38_HUMAN
    see all
  • Function
    Negative regulator of MAP3K1/2 signaling. Converts MAP3K2 from its phosphorylated form to its nonphosphorylated form and inhibits autophosphorylation of MAP3K2.
  • Tissue specificity
    Ubiquitously expressed with highest levels observed in peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    ISGylated.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab153177 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153177 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153177.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up