Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RAKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAFSQEKSRRVK EENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLR
    • Amino acids
      362 to 461
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCHT
    • DKFZp686K05124
    • OTTHUMP00000165175
    • PASK
    • Proline alanine rich STE20 related kinase
    • Serine threonine kinase 39
    • Serine threonine kinase 39 (STE20/SPS1 homolog yeast)
    • Serine/threonine protein kinase 39
    • Serine/threonine-protein kinase 39
    • Small intestine SPAK like kinase
    • SPAK
    • Ste 20 related kinase
    • Ste-20-related kinase
    • Ste20 like protein kinase
    • STE20/SPS1 homolog
    • STE20/SPS1 related proline alanine rich protein kinase
    • STE20/SPS1-related proline-alanine-rich protein kinase
    • STK 39
    • Stk39
    • STK39_HUMAN
    see all
  • Function
    May act as a mediator of stress-activated signals.
  • Tissue specificity
    Predominantly expressed in brain and pancreas followed by heart, lung, kidney, skeletal muscle, liver, placenta and testis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
  • Domain
    PAPA box (proline-alanine repeats) may target the kinase to a specific subcellular location by facilitating interaction with intracellular proteins such as actin or actin-like proteins.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus when caspase-cleaved.
  • Information by UniProt

Images

  • ab153297 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up