Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKRRASDRGAGETSARAKALGSGISGNNAKRAGPFILGPRLGNSPVPSIV QCLARKDGTDDFYQLKILTLEERGDQGIESQEERQGKMLLHTEYSLLSLL HTQDGVVHHHGLFQDRTCEIVEDTESSRMVKKMKKRICLVLDCLCAHDFS DKTADLINLQHYVIKEKRLSERETVVIFYDVVRVVEALHQKNIVHRDLKL GNMVLNKRTHRITITNFCLGKHLVSEGDLLKDQRGSPAYISPDVLSGRPY RGKPSDMWALGVVLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPEDGRVS ENTVCLIRKLLVLDPQQRLAAADVLEALSAIIASWQSLSSLSGPLQVVPD IDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVP KRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLRK
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 435
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310004N11Rik
    • MGC4796
    • OTTHUMP00000009948
    • OTTHUMP00000009951
    • RP11-268J15.4
    • Ser/Thr like kinase
    • Serine/threonine kinase 40
    • Serine/threonine protein kinase 40
    • SgK495
    • SHIK
    • SINK homologous serine/threonine protein kinase
    • SINK-homologous inhibitory kinase
    • STK 40
    • Sugen kinase 495
    see all
  • Relevance
    STK40 may be a negative regulator of NF-kappa-B and p53-mediated gene transcription. There are four named isoforms.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab132753 on 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up