Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKRRASDRGAGETSARAKALGSGISGNNAKRAGPFILGPRLGNSPVPSIV QCLARKDGTDDFYQLKILTLEERGDQGIESQEERQGKMLLHTEYSLLSLL HTQDGVVHHHGLFQDRTCEIVEDTESSRMVKKMKKRICLVLDCLCAHDFS DKTADLINLQHYVIKEKRLSERETVVIFYDVVRVVEALHQKNIVHRDLKL GNMVLNKRTHRITITNFCLGKHLVSEGDLLKDQRGSPAYISPDVLSGRPY RGKPSDMWALGVVLFTMLYGQFPFYDSIPQELFRKIKAAEYTIPEDGRVS ENTVCLIRKLLVLDPQQRLAAADVLEALSAIIASWQSLSSLSGPLQVVPD IDDQMSNADSSQEAKVTEECSQYEFENYMRQQLLLAEEKSSIHDARSWVP KRQFGSAPPVRRLGHDAQPMTSLDTAILAQRYLRK
    • Molecular weight
      74 kDa including tags
    • Amino acids
      1 to 435
    • Tags
      proprietary tag N-Terminus
    • Additional sequence information
      NM_032017

Associated products

Specifications

Our Abpromise guarantee covers the use of ab179956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    > 95 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 25% Glycerol, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.29% Sodium chloride, 0.002% PMSF

General Info

  • Alternative names
    • 2310004N11Rik
    • MGC4796
    • OTTHUMP00000009948
    • OTTHUMP00000009951
    • RP11-268J15.4
    • Ser/Thr like kinase
    • Serine/threonine kinase 40
    • Serine/threonine protein kinase 40
    • SgK495
    • SHIK
    • SINK homologous serine/threonine protein kinase
    • SINK-homologous inhibitory kinase
    • STK 40
    • Sugen kinase 495
    see all
  • Relevance
    STK40 may be a negative regulator of NF-kappa-B and p53-mediated gene transcription. There are four named isoforms.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • SDS-PAGE analysis of ab179956.

References

ab179956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up