Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EYERAIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEI LTKDSVTISVDGVVYYRVQNATLAVANITNADSA
    • Molecular weight
      35 kDa including tags
    • Amino acids
      59 to 142

Specifications

Our Abpromise guarantee covers the use of ab114909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BND7
    • EPB7
    • EPB72
    • Erythrocyte band 7 integral membrane protein
    • Erythrocyte membrane protein band 7.2 (stomatin)
    • Erythrocyte surface protein band 7.2
    • Protein 7.2b
    • STOM
    • STOM_HUMAN
    • Stomatin
    see all
  • Function
    Thought to regulate cation conductance. May regulate ACCN1 and ACCN3 gating.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the band 7/mec-2 family.
  • Cellular localization
    Cell membrane. Cell membrane. Melanosome. Exposed on the cytoplasmic surface of the membrane. Associated with lipid rafts. Concentrates preferentially in plasma membrane protrusions and in a juxta-nuclear region which may represent Golgi-derived vesicles. Colocalizes with actin. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Recombinant Human STOM protein images

  • 12.5% SDS-PAGE showing ab114909 at approximately 34.87kDa.
    Stained with Coomassie Blue.

References for Recombinant Human STOM protein (ab114909)

ab114909 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up