Recombinant Human STOML1 protein (ab160470)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGADVPQSW PSCLCHGLISFLGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQ GPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIW DPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLE INDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGS MNSMAGGAPSPGPADTVEMVSEVEPPAPQVGARSSPKQPLAEGLLTALQP FLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIPDV VVEMAEADLRALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLRALK
    • Amino acids
      1 to 398
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EPB72 like 1
    • hUNC 24
    • SLP 1
    • SLP1
    • Stomatin (EBP72) like 1
    • Stomatin related protein
    • STORP
    • UNC24
    see all
  • Relevance
    STOML1 belongs to the band 7/mec-2 family and contains one SCP2 domain. It is ubiquitously expressed at low levels; expression is highest in brain. There are two named isoforms.
  • Cellular localization
    Membrane; Single-pass type III membrane protein.

Images

  • ab160470 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160470 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160470.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up