Recombinant Human Striatin3 protein (ab162295)

Overview

  • Product name
    Recombinant Human Striatin3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSI RLWNLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV
    • Amino acids
      614 to 713
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162295 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cell cycle autoantigen SG2NA
    • Cell cycle S/G2 nuclear autoantigen
    • GS2NA
    • nuclear autoantigen
    • S/G2 antigen
    • SG2NA
    • Striatin 3
    • Striatin, calmodulin binding protein 3
    see all
  • Relevance
    Binds calmodulin in a calcium dependent manner. May function as scaffolding or signaling protein.
  • Cellular localization
    Cytoplasm. Membrane; Peripheral membrane protein.

Images

  • ab162295 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162295 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162295.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up