Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFP RARAQKALASTGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPL AQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFMCEDSKVDALGEALQTT VSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKT EVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGCDWVATIFSRD IRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS LTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERR PYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFG KYWLSQCFDAKGRYIRTNLNMPHSLPQRSGGFRDYEKDAPITVFGCMQAR LVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENHLKIRVEPGLF EWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYI SRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE
    • Amino acids
      1 to 649
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cbl interacting protein p70
    • Cbl interacting protein Sts 1
    • Cbl interacting protein Sts1
    • Cbl-interacting protein p70
    • KIAA1959
    • MGC15437
    • Nm23 phosphorylated unknown substrate
    • p70
    • SH3 domain containing 70 kDa protein
    • Sts 1
    • STS-1
    • STS1
    • Suppressor of T cell receptor signaling 1
    • Suppressor of T-cell receptor signaling 1
    • T-cell ubiquitin ligand 2
    • TULA-2
    • Tyrosine-protein phosphatase STS1/TULA2
    • Ubash3b
    • Ubiquitin associated and SH3 domain containing B
    • Ubiquitin-associated and SH3 domain-containing protein B
    • UBS3B_HUMAN
    see all
  • Function
    Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors and EGFR, on the cell surface. Exhibits tyrosine phosphatase activity toward several substrates including EGFR, FAK, SYK, and ZAP70. Down-regulates proteins that are dually modified by both protein tyrosine phosphorylation and ubiquitination.
  • Sequence similarities
    Contains 1 SH3 domain.
    Contains 1 UBA domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab153560 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up