Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      REQRTQQQRSGPQGIAPVPPPRDLSWEAGHGGNVALPLKETSVENFLGAT TPALAKLQVPREQLSEVLEQICSGSCGPIFRANMNTGDPSKPKSVILKAL KEPAGLHEVQ
    • Amino acids
      50 to 159
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp761P1010
    • NOK
    • Novel oncogene with kinase domain
    • Protein kinase STYK1
    • Protein PK unique
    • Protein PK-unique
    • Serine/threonine/tyrosine kinase 1
    • Styk 1
    • STYK1
    • STYK1_HUMAN
    • SuRTK 106
    • SuRTK106
    • Tyrosine protein kinase STYK1
    • Tyrosine-protein kinase STYK1
    see all
  • Function
    Probable tyrosine protein-kinase, which has strong transforming capabilities on a variety of cell lines. When overexpressed, it can also induce tumor cell invasion as well as metastasis in distant organs. May act by activating both MAP kinase and phosphatidylinositol 3'-kinases (PI3K) pathways.
  • Tissue specificity
    Widely expressed. Highly expressed in brain, placenta and prostate. Expressed in tumor cells such as hepatoma cells LO2, cervix carcinoma cells HeLa, ovary cancer cells Ho8910 and chronic myelogenous leukemia cells K562, but not in other tumor cells such as epidermoid carcinoma (A431). Undetectable in most normal lung tissues, widely expressed in lung cancers.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab163082 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up