Recombinant Human SUCLA2 protein (ab152914)

Overview

  • Product name
    Recombinant Human SUCLA2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAASMFYGRLVAVATLRNHRPRTAQRAAAQVLGSSGLFNNHGLQVQQQQQ RNLSLHEYMSMELLQEAGVSVPKGYVAKSPDEAYAIAKKLGSKDVVIKAQ VLAGGRGKGTFESGLKGGVKIVFSPEEAKAVSSQMIGKKLFTKQTGEKGR ICNQVLVCERKYPRREYYFAITMERSFQGPVLIGSSHGGVNIEDVAAESP EAIIKEPIDIEEGIKKEQALQLAQKMGFPPNIVESAAENMVKLYSLFLKY DATMIEINPMVEDSDGAVLCMDAKINFDSNSAYRQKKIFDLQDWTQEDER DKDAAKANLNYIGLDGNIGCLVNGAGLAMATMDIIKLHGGTPANFLDVGG GATVHQVTEAFKLITSDKKVLAILVNIFGGIMRCDVIAQGIVMAVKDLEI KIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLA KQAHVDVKFQLPI
    • Amino acids
      1 to 463
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A BETA
    • A SCS
    • ATP specific succinyl CoA synthetase subunit beta
    • ATP specific succinyl CoA synthetase, beta subunit
    • ATP-specific succinyl-CoA synthetase subunit beta
    • Mitochondrial succinyl CoA ligase [ADP forming] subunit beta
    • MTDPS5
    • Renal carcinoma antigen NY-REN-39
    • Renal carcinoma antigen NYREN39
    • SCS betaA
    • SCS-betaA
    • SUCB1_HUMAN
    • Succinate CoA ligase (ADP forming)
    • Succinate CoA ligase [ADP forming] subunit beta, mitochondrial; succinyl CoA ligase [ADP forming] subunit beta, mitochondrial
    • Succinate CoA ligase ADP forming beta subunit
    • Succinate CoA ligase beta subunit
    • Succinyl CoA ligase [ADP-forming] subunit beta, mitochondrial
    • Succinyl CoA synthetase beta A chain
    • Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial
    • Succinyl-CoA synthetase beta-A chain
    • SUCLA2
    see all
  • Function
    Catalyzes the ATP-dependent ligation of succinate and CoA to form succinyl-CoA.
  • Tissue specificity
    Widely expressed. Not expressed in liver and lung.
  • Pathway
    Carbohydrate metabolism; tricarboxylic acid cycle; succinate from succinyl-CoA (ligase route): step 1/1.
  • Involvement in disease
    Mitochondrial DNA depletion syndrome 5
  • Sequence similarities
    Belongs to the succinate/malate CoA ligase beta subunit family.
    Contains 1 ATP-grasp domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab152914 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up